Everything below concerns hydrolysis. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-09-22. Numbers and descriptions here follow the published literature rather than marketing material.
Whey protein hydrolysate is a dairy-derived ingredient made by treating whey protein with enzymes or acid to break peptide bonds. The starting material is typically sweet whey or acid whey from cheese manufacture, which contains beta-lactoglobulin, alpha-lactalbumin, bovine serum albumin, and immunoglobulins. Hydrolysis shortens protein chains into peptides and free amino acids, changing solubility, viscosity, and taste. The extent of breakdown is described by degree of hydrolysis, a percentage of cleaved peptide bonds. This value influences functional and sensory properties but does not by itself define a specific molecular profile.
Commercial production usually begins with whey protein concentrate or isolate, not raw whey, to reduce fat and lactose. Food-grade proteases from bacterial or plant sources are added under controlled temperature and pH, then inactivated by heat or pH adjustment. The resulting liquid may be clarified, filtered, concentrated, and spray-dried into powder. Enzyme choice, reaction time, and pretreatment conditions create products with different peptide size distributions. Because these variables are proprietary and not standardized, two hydrolysates with the same degree of hydrolysis can differ in peptide sequences and mineral content.
Composition reflects both the original whey and the hydrolysis process. Products contain protein-derived peptides, variable ash, moisture, and residual lactose or fat depending on filtration. Some free amino acids increase during hydrolysis, and bitterness often rises with higher degrees of hydrolysis due to exposed hydrophobic residues. Mineral profiles vary with the whey source and any neutralization step. Allergenicity may be reduced in extensively hydrolyzed products, but the extent depends on residual intact protein and peptide size, and this remains a subject of ongoing study.
Advanced peptide profiling uses liquid chromatography coupled with mass spectrometry to identify fragments and assess batch consistency. Amino acid analysis after acid hydrolysis quantifies the building blocks and can reveal deviations from expected composition. Residual enzyme activity may be monitored in products where active enzymes are undesirable. Allergen tests often use immunoassays for beta-lactoglobulin, but hydrolysis can reduce or alter epitope recognition, so negative results do not prove absence of allergenic potential. Physical tests include particle size, bulk density, and reconstitution behavior.
Regulatory and labeling frameworks vary by country. In the United States, whey protein hydrolysate may be regulated as a food ingredient or a dietary supplement ingredient depending on intended use. In the European Union, it falls under general food law, with additional rules for infant formula and foods for special medical purposes. A claim of hypoallergenicity is not established by hydrolysis alone and generally requires clinical evidence. Open questions remain about how degree of hydrolysis relates to bitterness, nitrogen absorption, and residual allergenicity across different products and processing methods.
| Property | Value | Notes |
|---|---|---|
| Appearance | Off-white to cream powder | Color varies with source and drying. |
| Solubility | High in water; pH-dependent | Shorter peptides often dissolve more readily than intact protein. |
| Typical storage temperature | 15–25 °C, dry conditions | Cool, dry storage limits moisture uptake and browning. |
| Common analytical method | Kjeldahl or Dumas for total nitrogen | Estimates protein content; not peptide size. |
| Common synonyms | Hydrolyzed whey protein; whey peptide | Hydrolysate spelling is standard in scientific use. |
Composition reflects the whey source and the extent of hydrolysis. Beta-lactoglobulin and alpha-lactalbumin fragments are common, and sweet whey may contribute glycomacropeptide. The amino acid profile remains broadly similar to intact whey protein, but peptide size affects how quickly nitrogen appears in blood after ingestion. Bitter notes often arise from short peptides with hydrophobic residues. Hydrolysates are used in sports nutrition, infant formula, and clinical nutrition, though effects on muscle, immunity, or allergy risk are separate research questions rather than guaranteed properties.
Whey protein hydrolysate is derived from whey, the liquid byproduct of cheese-making or casein coagulation. It consists of peptides and free amino acids produced when peptide bonds are cleaved by enzymes or acid. Hydrolysis lowers the average molecular weight and can change solubility, viscosity, and bitterness. The degree of hydrolysis indicates the proportion of peptide bonds broken and distinguishes partial from extensive hydrolysates. Commercial ingredients vary widely in peptide size, mineral content, and lactose level.
Production usually starts with whey protein concentrate or isolate. The material is dissolved, pasteurized, and adjusted to conditions that favor a chosen protease, such as trypsin, pepsin, or papain. Enzyme choice, pH, temperature, and reaction time determine peptide length, terminal residues, and functional behavior. After hydrolysis, the enzyme is inactivated by heat or pH change, and the liquid is clarified, filtered, concentrated, and dried. Membrane filtration can further fractionate peptides and remove some minerals or lactose. The final powder is typically spray-dried.
Hydrolysates are generally stable as dry powders but can absorb moisture and undergo browning during warm storage. The bitter taste of some hydrolysates arises from hydrophobic peptides exposed by cleavage, and it varies with enzyme choice and degree of hydrolysis. Reduced allergenicity is sometimes claimed, but residual IgE-binding peptides may remain, especially in partial hydrolysates. Regulatory frameworks treat extensively hydrolyzed and partially hydrolyzed products differently, and labeling rules vary by country. More research is needed on how specific peptide profiles relate to clinical outcomes.
Commercial production begins with whey protein concentrate or isolate dissolved in water. A protease is added under controlled pH and temperature, and the reaction is stopped by heat or pH adjustment once a target degree of hydrolysis is reached. Membrane filtration, often ultrafiltration or diafiltration, removes enzymes and small solutes while retaining peptides. The liquid is then concentrated and spray-dried into a powder. Each step influences peptide length, mineral content, and flavor.
The parent whey proteins include beta-lactoglobulin, alpha-lactalbumin, serum albumin, immunoglobulins, and glycomacropeptide, depending on the whey source. Hydrolysis does not remove these sequences; it fragments them into peptides of varying length. The peptide distribution depends on the enzyme specificity, reaction time, temperature, pH, and enzyme-to-substrate ratio. Because the mixture is heterogeneous, a single molecular weight cannot describe the product. Instead, laboratories report a distribution, often spanning from a few hundred to several thousand daltons.
Whey protein hydrolysate appears in foods and supplements where rapid digestion, low viscosity, or reduced intact-protein content is desired. It is distinct from whey protein isolate and concentrate, which contain largely intact proteins, though hydrolysates can be made from either. In infant formula, extensively hydrolyzed whey is used in some specialty products, while partially hydrolyzed forms appear in other formulations. Human health effects depend on the specific peptide mixture and are not uniform across all hydrolysates.
Whey protein hydrolysate is a dairy ingredient produced when whey proteins are treated with proteolytic enzymes or, less commonly, acid or heat under controlled conditions. The treatment cleaves peptide bonds and yields shorter peptide chains than those found in intact whey protein. The starting material is usually sweet whey or acid whey from cheese manufacture, concentrated by membrane filtration before hydrolysis. The resulting ingredient retains many amino acids from the original protein but differs in molecular size, solubility, and taste profile.
Alpha-synuclein primary structure is usually divided in three distinct domains: Residues 1-60: An amphipathic N-terminal region dominated by four 11-residue repeats including the consensus sequence KTKEGV. This sequence has a structural alpha helix propensity similar to apolipoproteins-binding domains. It is a highly conserved terminal that interacts with acidic lipid membranes, and all the discovered point mutations of the SNCA gene are located within this terminal. Residues 61-95: A central hydrophobic region which includes the non-amyloid-β component (NAC) region, involved in protein aggregation. This domain is unique to alpha-synuclein among the synuclein family. Residues 96-140: a highly acidic and proline-rich region which has no distinct structural propensity. This domain plays an important role in the function, solubility and interaction of alpha-synuclein with other proteins.
The major cell-matrix adhesion receptors are integrins and therefore the adhesome of cell-matrix adhesion is referred to as the integrin adhesome. Cell-cell adhesion is primarily mediated by cadherin receptors and therefore the adhesome of cell-cell adhesion is referred to as the cadherin adhesome or cadhesome. The first attempts to establish the set of proteins that participate directly ('bona fide' adhesome components) or affect indirectly ('associated' adhesome components) cell adhesion were based on mining of the primary research literature, and resulted in approximately 200 protein in either integrin or cadherin adhesomes. Later, unbiased proteomic approaches utilizing mass spectrometry have detected hundreds more proteins associated with integrin adhesions. However, a comparison of multiple proteomic studies of the integrin adhesome of fibroblasts attached to fibronectin found only 60 proteins common to all studies. Humphries and co-workers named these 60 proteins the 'consensus integrin adhesome'.
POMC, ACTH and β-lipotropin are secreted from corticotropic cells in the anterior lobe (or adenohypophysis) of the pituitary gland in response to the hormone corticotropin-releasing hormone (CRH) released by the hypothalamus. The pre-pro-opiomelanocortin (Pre-POMC) is the precursor of POMC, its cleavage forms POMC. ACTH, on the other hand, is produced from the cleavage of POMC. The removal of the signal peptide during translation produces the 241-amino acid polypeptide POMC, which undergoes a series of post-translational modifications such as phosphorylation and glycosylation before it is proteolytically cleaved by endopeptidases to yield various polypeptide fragments with varying physiological activity. These fragments include:
After synthesizing and purifying the core, the carbohydrate layer is added to its surface. Common coating materials are typically polyhydroxy oligomers such as cellobiose, citrate, lactose, and sucrose. This layer seems to be important for the properties of aquasomes, as it influences several drug characteristics including adsorption, molecular stability, and conformation (shape), and acts as a dehydroprotectant. The addition of the carbohydrate layer to the surface of the nanocrystalline core is commonly carried out by passive adsorption through incubation and sonication. Similar to the processing of the core, the carbohydrate layer is subjected to centrifugation, washing, and further sonification followed by heated air drying. Finally, the bioactive molecule of interest is loaded into the carbohydrate layer. This process typically occurs through either lyophilization or passive adsorption, and the fully functionalized aquasome is then characterized.
Sources: en.wikipedia.org
In 80–85% of cases, the ALK detected in ALK-positive ALCL is a NPM1-ALK fusion protein. It is made by a fusion of NPM1 gene, which makes nucleophosmin 1, located on the long or "q" arm of chromosome 5 at position 35 (notated as 5q35) with the ALK gene located on the short or "p" arm of chromosome 2 at position 23 (notated as 2p23) to form a chimeric gene notated as (2;5)(p23;q35). In 13% of cases ALK fuses with the TPM3 gene or in <1% of cases for each of the following genes: TFG, ATIC, CLTC, TPM4, MSN, RNF213 (also termed ALO17), MYH9, or TRAF1. All of these fusion proteins are considered to act like NPMI-ALK in possessing high ALK activity that promotes the development and progression ALK-positive ALCL by activating the cell signaling pathways cited in the Introduction. 15% Of individuals with ALK-positive ALCL also have point mutations in the NOTCH1 gene. While most of these abnormalities are thought to be detrimental not all are. For example, DUSP22 gene rearrangements are associated with favorable outcomes in ALK-positive (as well as ALK-negative) ALCL.
Isoforms I, III, and VIII are also stimulated by Ca2+/calmodulin. Isoforms V and VI are inhibited by Ca2+ in a calmodulin-independent manner. Isoforms II, IV and IX are stimulated by alpha subunit of the G protein. Isoforms I, V and VI are most clearly inhibited by Gi, while other isoforms show less dual regulation by the inhibitory G protein. Soluble AC (sAC) is not a transmembrane form and is not regulated by G proteins or forskolin, instead acts as a bicarbonate/pH sensor. It is anchored at various locations within the cell and, with phosphodiesterases, forms local cAMP signalling domains. In neurons, calcium-sensitive adenylyl cyclases are located next to calcium ion channels for faster reaction to Ca2+ influx; they are suspected of playing an important role in learning processes. This is supported by the fact that adenylyl cyclases are coincidence detectors, meaning that they are activated only by several different signals occurring together. In peripheral cells and tissues adenylyl cyclases appear to form molecular complexes with specific receptors and other signaling proteins in an isoform-specific manner.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Genetically modified organism History of biotechnology An Asilomar Moment Archived 10 July 2013 at the Wayback Machine Original Asilomar Genetics Guidelines “Asilomar Conference.” Provides another summary of the Asilomar Conference. The Basics of Recombinant DNA provides an introduction to the science behind recombinant DNA. The Recombinant DNA Debate Archived 31 March 2007 at the Wayback Machine provides more details about the history of the debate surrounding the use of recombinant DNA technology. “Paul Berg: The 1980 Nobel Prize in Chemistry – Autobiography.” Provides an autobiography about Paul Berg. Science History Institute: The story of the 1975 Asilomar Conference on Recombinant DNA
The AlphaFold Protein Structure Database (AlphaFold DB) is a collaborative project with Google DeepMind to make predicted protein structures from the AlphaFold AI system freely available to the scientific community. The first release of the database was in 2021; as of 2024, AlphaFold DB provides access to over 214 million protein structures. National Center for Biotechnology Information (NCBI), United States National Library of Medicine National Institute of Genetics (DNA Data Bank of Japan) Swiss Institute of Bioinformatics (SIB: Expasy) Australia Bioinformatics Resource BIG Data Center (National Genomics Data Center), Beijing Institute of Genomics, Chinese Academy of Sciences Alternative splicing and transcript diversity database BioJS - open-source project for bioinformatics data on the web BioSamples European Molecular Biology Organization European Nucleotide Archive
Sources: en.wikipedia.org
It is whey protein that has been broken into smaller peptides and amino acids through enzymatic or acid hydrolysis. The resulting ingredient is used in food and nutritional products for its altered functional and sensory properties. It is not a single uniform substance because production conditions vary.
Hydrolysis targets peptide bonds, not lactose, so the lactose content depends mainly on the starting whey protein concentrate or isolate. Filtration steps before or after hydrolysis can reduce lactose. A hydrolysate labeled as isolate typically contains less lactose than one derived from concentrate.
No. Whey isolate refers to a high-protein, low-fat, low-lactose whey fraction, while hydrolysate refers to protein that has been cleaved into smaller peptides. A product can be both whey isolate and hydrolyzed. The terms describe different processing dimensions.
It is often estimated by TNBS, OPA, or pH-stat methods that quantify free amino groups or released protons. Values depend on assay conditions, protein standard, and calculation method. No single universal protocol exists for all products.