Everything below concerns Allergen labeling. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-07-24. Where a claim depends on a specific study, the study is described rather than over-claimed.
Whey protein hydrolysate powders are hygroscopic and can absorb moisture from air. Moisture uptake may lead to caking, reduced flowability, and gradual peptide degradation. Manufacturers typically specify cool, dry storage and sealed packaging to limit these changes. Water activity, rather than water content alone, is often monitored because it better predicts microbial and chemical stability. High temperatures can accelerate Maillard reactions between peptides and residual sugars, altering color and flavor. Exact shelf lives depend on formulation, packaging, and initial moisture, so they are usually determined by product-specific stability testing.
Analytical testing for whey protein hydrolysate focuses on peptide size distribution, degree of hydrolysis, protein content, moisture, ash, and microbiological quality. Size-exclusion chromatography and mass spectrometry can characterize peptide profiles, while Kjeldahl or combustion methods estimate total nitrogen and protein. Amino acid analysis quantifies free and total amino acids. Because peptide mixtures are complex, no single method captures every property, and results can vary between laboratories. Standardized methods and reference materials help improve comparability, but full sequence-level characterization remains uncommon in routine quality control.
Regulatory treatment of whey protein hydrolysate depends on the country and intended use. In many jurisdictions it is regulated as a food ingredient or food for special dietary use, not as a drug. Labeling rules govern allergen statements, protein content claims, and ingredient names. Some markets have specific rules for infant formula ingredients, where hydrolysates may be used for particular dietary purposes. Regulations generally focus on safety, truthful labeling, and manufacturing standards rather than on therapeutic effects. Scientific questions about specific peptide activities remain an active area of research rather than a settled regulatory category.
Laboratories characterize whey protein hydrolysate by several complementary methods. Total nitrogen or Kjeldahl analysis estimates crude protein, while amino acid analysis gives a more detailed composition. Size-exclusion chromatography and mass spectrometry separate peptides by molecular weight and can reveal the distribution of chain lengths. Degree of hydrolysis is often calculated from free amino groups using trinitrobenzenesulfonic acid or o-phthaldialdehyde assays. No single measurement captures all relevant properties, so specifications usually combine protein content, peptide profile, moisture, ash, and microbial limits.
Storage stability depends on moisture, temperature, oxygen, and packaging. Dry hydrolysate powders are typically stable for months to years when kept cool and sealed, but they can absorb water and cake if exposed to humid air. Higher temperatures accelerate Maillard reactions between peptides and residual sugars, leading to browning and flavor changes. Lipid oxidation can occur if residual fat is present, producing off-odors. Once a powder is reconstituted, microbial growth becomes a concern, so liquid forms require refrigeration or other preservation steps.
Quality control for hydrolysates often includes allergen and contaminant checks. Because whey is a milk-derived ingredient, milk protein residues may remain, and the extent to which hydrolysis reduces allergenic potential is product-specific and not fully predictable. Tests may screen for heavy metals, melamine, pesticides, and microbial indicators. Enzyme residues and processing aids are also monitored when regulations require it. Batch-to-batch consistency is assessed through peptide mapping or functional tests, since small process changes can alter taste, solubility, or nutritional performance.
| Property | Value | Notes |
|---|---|---|
| Moisture content | Typically below 6% for dry powders | Higher moisture can promote caking and degradation. |
| Water activity | Often below 0.6 | Low water activity limits microbial growth. |
| Typical storage temperature | 15–25 °C (cool, dry) | Avoid heat and humidity; follow label specifications. |
| Common analytical method | Size-exclusion chromatography | Used to estimate peptide molecular weight distribution. |
| Common synonym | Hydrolyzed whey protein | Not identical to whey protein isolate or concentrate. |
These drugs have been derived from NSAIDs. The cyclooxygenase enzyme inhibited by NSAIDs was discovered to have at least two different versions: COX-1 and COX-2. Research suggested most of the adverse effects of NSAdiated by blocking the COX-1 (constitutive) enzyme, with the analgesic effects being mediated by the COX-2 (inducible) enzyme. Thus, the COX-2 inhibitors were developed to inhibit only the COX-2 enzyme (traditional NSAIDs block both versions in general). These drugs (e.g., rofecoxib, celecoxib, and etoricoxib) are equally effective analgesics when compared with NSAIDs, but cause less gastrointestinal hemorrhage in particular. After widespread adoption of the COX-2 inhibitors, it was discovered that most of the drugs in this class increase the risk of cardiovascular events by 40% on average. This led to the withdrawal of rofecoxib and valdecoxib, and warnings on others. Etoricoxib seems relatively safe, with the risk of thrombotic events similar to that of non-coxib NSAID diclofenac.
Arabinogalactan-proteins (AGPs) are highly glycosylated proteins (glycoproteins) found in the cell walls of plants. Each one consists of a protein with sugar molecules attached (which can account for more than 90% of the total mass). They are members of the wider class of hydroxyproline (Hyp)-rich cell wall glycoproteins, a large and diverse group of glycosylated wall proteins. AGPs have been reported in a wide range of higher plants in seeds, roots, stems, leaves and inflorescences. AGPs account for only a small portion of the cell wall, usually no more than 1% of dry mass of the primary wall. They have also been reported in secretions of cell culture medium of root, leaf, endosperm and embryo tissues, and some exudate producing cell types such as stylar canal cells are capable of producing lavish amounts of AGPs. They are implicated in various aspects of plant growth and development, including root elongation, somatic embryogenesis, hormone responses, xylem differentiation, pollen tube growth and guidance, programmed cell death, cell expansion, salt tolerance, host-pathogen interactions, and cellular signaling. AGPs have attracted considerable attention due to their highly complex structures and potential roles in signalling. In addition, they have industrial and health applications due to their chemical/physical properties (water-holding, adhesion and emulsification).
Solid-liquid extraction based ambient ionization is based on the use of a charged spray, for example electrospray to create a liquid film on the sample surface. Molecules on the surface are extracted into the solvent. The action of the primary droplets hitting the surface produces secondary droplets that are the source of ions for the mass spectrometer. Desorption electrospray ionization (DESI) is one of the original ambient ionization sources and uses an electrospray source to create charged droplets that are directed at a solid sample. The charged droplets pick up the sample through interaction with the surface and then form highly charged ions that can be sampled into a mass spectrometer. Desorption atmospheric pressure photoionization (DAPPI) is a solid-liquid extraction ambient ionization method that enables the direct analysis of samples deposited on surfaces by means of a jet of hot solvent vapour and ultraviolet light. The hot jet thermally desorbs the sample from a surface and the vaporized sample is ionized by a vacuum ultraviolet light and consequently sampled into a mass spectrometer.
Sources: en.wikipedia.org
A common SNP in the BDNF gene is rs6265. This point mutation in the coding sequence, a guanine to adenine switch at position 196, results in an amino acid switch: valine to methionine exchange at codon 66, Val66Met, which is in the prodomain of BDNF. Val66Met is unique to humans. The mutation interferes with normal translation and intracellular trafficking of BDNF mRNA, as it destabilizes the mRNA and renders it prone to degradation. The proteins resulting from mRNA that does get translated, are not trafficked and secreted normally, as the amino acid change occurs on the portion of the prodomain where sortilin binds; and sortilin is essential for normal trafficking. The Val66Met mutation results in a reduction of hippocampal tissue and has since been reported in a high number of individuals with learning and memory disorders, anxiety disorders, major depression, and neurodegenerative diseases such as Alzheimer's and Parkinson's. A meta-analysis indicates that the BDNF Val66Met variant is not associated with serum BDNF.
At the active site, a substrate binds to an enzyme to induce a chemical reaction. Substrates, transition states, and products can bind to the active site, as well as any competitive inhibitors. For example, in the context of protein function, the binding of calcium to troponin in muscle cells can induce a conformational change in troponin. This allows for tropomyosin to expose the actin-myosin binding site to which the myosin head binds to form a cross-bridge and induce a muscle contraction. In the context of the blood, an example of competitive binding is carbon monoxide which competes with oxygen for the active site on heme. Carbon monoxide's high affinity may outcompete oxygen in the presence of low oxygen concentration. In these circumstances, the binding of carbon monoxide induces a conformation change that discourages heme from binding to oxygen, resulting in carbon monoxide poisoning.
The C-terminal domain of ADP-ribose diphosphatase contains the Nudix sequence, a highly conserved amino acid sequence that is found in over 450 putative proteins in about 90 different species. A part of this sequence known as the Nudix fold is the catalytic part of the sequence. It is a structurally conserved loop-helix-loop motif that creates a scaffold for metal binding and pyrophosphatase chemistry in the enzyme. ADP-ribose hydrolases in general act as protective agents against excessive intracellular accumulation of ADP-ribose, as high intracellular levels of ADP-ribose can be damaging to the cell. ADP-ribose diphosphatase, in particular, hydrolyzes ADP-ribose into AMP and D-ribose 5-phosphate, both of which are intermediates of central metabolic pathways and therefore are easily reused. Other common names for ADP-ribose diphosphatase include ADP-ribose pyrophosphatase and ADPRase. ADP-ribose is commonly referred to as ADPR.
Sources: en.wikipedia.org
In response to a stimulus, GPCRs activate heterotrimeric G proteins. In order to turn off this response, or adapt to a persistent stimulus, active receptors need to be desensitized. The first step in desensitization is phosphorylation of the receptor by a class of serine/threonine kinases called G protein coupled receptor kinases (GRKs). GRK phosphorylation specifically prepares the activated receptor for arrestin binding. Arrestin binding to the receptor blocks further G protein-mediated signaling and targets receptors for internalization, and redirects signaling to alternative G protein-independent pathways, such as β-arrestin signaling. In addition to GPCRs, arrestins bind to other classes of cell surface receptors and a variety of other signaling proteins. Mammals express four arrestin subtypes and each arrestin subtype is known by multiple aliases. The systematic arrestin name (1–4) plus the most widely used aliases for each arrestin subtype are listed in bold below:
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The AAV genome is built of single-stranded deoxyribonucleic acid (ssDNA), either positive- or negative-sensed, which is about 4.7 kilobase long. The genome comprises ITRs at both ends of the DNA strand, and two open reading frames (ORFs): rep and cap. The former is composed of four overlapping genes encoding Rep proteins required for the AAV life cycle, and the latter contains overlapping nucleotide sequences of capsid proteins: VP1, VP2 and VP3, which interact to form a capsid with icosahedral symmetry.
Sources: en.wikipedia.org
It is generally stored in a sealed container in a cool, dry place away from strong odors. Moisture and heat can cause caking, flavor changes, and peptide degradation. Product-specific labels and stability data should guide actual storage conditions.
Common tests measure moisture, water activity, protein content, ash, microbiological safety, and degree of hydrolysis. Peptide size distribution may be checked by chromatography. Not every batch receives full sequence-level analysis because such testing is complex and costly.
Not necessarily, because hydrolysis can reduce the size of some allergenic proteins while residual allergenic sequences may remain depending on the process. Milk is still a major allergen, and labeling rules usually require milk allergen disclosure unless a specific exemption applies. The term hydrolysate alone does not establish hypoallergenicity.
Degree of hydrolysis is commonly estimated by quantifying free amino groups with colorimetric assays such as o-phthaldialdehyde or trinitrobenzenesulfonic acid. The result is expressed as a percentage of total peptide bonds cleaved. Because different assays can give different values, method details matter when comparing products.